Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SML3264

Sigma-Aldrich

Teduglutide trifluoroacetate

≥95% (HPLC)

Sinónimos:

ALX 0600, TFA salt, ALX-0600, TFA salt, ALX0600, TFA salt, HGDGSFSDEMNTILDNLAARDFINWLIQTKITD, TFA salt, His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp, TFA salt, [Gly2]-GLP-2 (human), TFA salt, [Gly2]-Glucagon-like peptide II (human), TFA salt, [Gly2]GLP-2 (human), TFA salt

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352200
NACRES:
NA.77
En este momento no podemos mostrarle ni los precios ni la disponibilidad

Nivel de calidad

Ensayo

≥95% (HPLC)

Formulario

powder

condiciones de almacenamiento

desiccated

color

white to off-white

temp. de almacenamiento

−20°C

Acciones bioquímicas o fisiológicas

Dipeptidyl peptidase IV (DPP IV)-resistant glucagon-like peptide 2 (GLP-2) analog with clinical efficacy for the treatment of short bowel syndrome (SBS).
Teduglutide is a dipeptidyl peptidase IV (DPP IV)-resistant glucagon-like peptide 2 (GLP-2) analog with clinical efficacy for the treatment of gastrointestinal diseases, including short bowel syndrome (SBS), by promoting crypt cell proliferation, villus height expansion, and nutrient absorption. Experimental models of intestinal injury suggest that GLP-2 signaling exerts protective effects by increasing mesenteric blood flow, reducing intestinal inflammation, and facilitating structural and functional adaptation following major small bowel resection.

Código de clase de almacenamiento

11 - Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

C Booth et al.
Cell proliferation, 37(6), 385-400 (2004-11-19)
Glucagon-like peptide-2 and its dipeptidyl peptidase (DP-IV) resistant analogue teduglutide are trophic for the gastrointestinal epithelium. Exposure increases villus height and crypt size and results in increased overall intestinal weight. As these effects may be mediated through stimulation of the
Ferenc Sipos et al.
Journal of investigative surgery : the official journal of the Academy of Surgical Research, 31(3), 253-255 (2017-06-08)
Malabsorption is a major and common clinical characteristics of short bowel syndrome (SBS) and inflammatory bowel diseases (IBD). Traditional treatment opportunities have focused on decreasing malabsorptive losses via dietary modifications and antisecretory/antidiarrheal agents. However, novel therapeutic modalities aim to enhance
Pernille Wismann et al.
Physiology & behavior, 192, 72-81 (2018-03-16)
Analogues of several gastrointestinal peptide hormones have been developed into effective medicines for treatment of diseases such as type 2 diabetes mellitus (T2DM), obesity and short bowel syndrome (SBS). In this study, we aimed to explore whether the combination of
Rasmus Hytting-Andreasen et al.
PloS one, 13(6), e0198046-e0198046 (2018-06-05)
Mucositis is a side effect of chemotherapy seen in the digestive tract, with symptoms including pain, diarrhoea, inflammation and ulcerations. Our aim was to investigate whether endogenous glucagon-like peptide -1 and -2 (GLP-1 and GLP-2) are implicated in intestinal healing
Beatriz Pinto Costa et al.
Nutricion hospitalaria, 35(1), 185-193 (2018-03-23)
Teduglutide is an enterotrophic analogue of glucagon-like peptide-2, with an indirect and poorly understood mechanism of action, approved for the rehabilitation of short-bowel syndrome. This study aims to analyze the response of tissue growth factors to surgical injury and teduglutide

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico