SAB2109154

Anti-SPARC (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: ON
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 35 kDa
• species reactivity (predicted by homology): sheep, guinea pig, goat, bovine, canine, mouse, zebrafish, rabbit, horse, human
• concentration: 0.5 mg/mL
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL; western blot: 1 μg/mL
• NCBI accession no.: NM_003118
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SPARC(57396)

Descripción

General description

Secreted protein acidic and rich in cysteine/osteonectin/BM40, or SPARC, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ECM).

Sequence

Synthetic peptide located within the following region: LAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable