Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

SAB2108453

Sigma-Aldrich

Anti-TFEB

affinity isolated antibody

Sinónimos:

Anti-Math5

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

53 kDa

reactividad de especies

horse, human, rabbit, pig, mouse, goat, bovine, rat

concentración

0.5-1 mg/mL

técnicas

immunoblotting: suitable

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TFEB(7942)

Descripción general

Transcription factor EB (TFEB) is encoded by the gene mapped to human chromosome 6p21.1. The encoded protein belongs to the MiT transcription factor family. TFEB is widely expressed and is characterized with a transactivation domain, basic-helix-loop-helix domain, glutamine rich region, leucine zipper region and proline rich region.

Inmunógeno

Synthetic peptide directed towards the middle region of human TFEB

Acciones bioquímicas o fisiológicas

Transcription factor EB (TFEB) plays a key role in the regulation of autophagy and lysosome biogenesis. TFEB, expressed in endothelial cells, reduces inflammation and hinders atherosclerosis development. Thus, this protein can be considered as a potent therapeutic target for atherosclerosis and associated cardiovascular diseases.

Secuencia

Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Molecular Genetics and Cellular Characteristics of TFE3 and TFEB Translocation Renal Cell Carcinomas
Kauffman EC, et al.
Nature reviews. Urology, 11(8), 465-465 (2014)
The Transcription Factor EB Links Cellular Stress to the Immune Response
Nabar NR, et al.
The Yale Journal of Biology and Medicine, 90(2), 301-315 (2017)
TFEB inhibits endothelial cell inflammation and reduces atherosclerosis.
Lu H, et al.
Science Signaling, 10(464) (2017)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico