SAB2107648

Anti-DNASE1L3 antibody produced in rabbit

affinity isolated antibody

• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 34 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NM_004944
• Nº de acceso UniProt: Q13609
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... DNASE1L3(1776)

Descripción

Descripción general

DNASE1L3 (Deoxyribonuclease I-like 3) is a 32kDa endonuclease protein expressed in the spleen, liver, thymus, lymph node, bone marrow, small intestine and kidney. It consists of an N-terminal signal peptide responsible for the rER (rough endoplasmic reticulum) transport.

Inmunógeno

The immunogen for anti-DNASE1L3 antibody: synthetic peptide derected towards the C terminal of human DNASE1L3

Aplicación

Anti-DNASE1L3 antibody produced in rabbit is suitable for western blot and indirect ELISA.

Acciones bioquímicas o fisiológicas

DNASE1L3 (Deoxyribonuclease I-like 3) is involved in residual nuclease activity of internucleosomal chromatin. In presence of Ca²⁺/Mg²⁺, it produces 3′-OH/5′-P ends by cleaving both the DNA strand, double-stranded and single-stranded DNA molecule. It has also been reported that DNASE1L3 may cleave apoptotic DNA of thymocytes, neuronal PC12 cells, C2C12 myoblasts and of cell lines expressing the recombinant nuclease. Mutation in DNASE1L3 causes a rare syndrome, hypocomplementemic urticarial vasculitis syndrome (HUVS).

Secuencia

Synthetic peptide located within the following region: DFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable