MSST0033

SILu^™Prot COL1A1 N-terminal propeptide human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Sinónimos: Collagen alpha-1(I) chain, Collagenalpha-1(I)chain, P1NP
• UNSPSC Code: 23201100
• NACRES: NA.12

Propiedades

• biological source: human
• Quality Level: 200
• recombinant: expressed in HEK 293 cells
• assay: ≥98% (SDS-PAGE)
• form: lyophilized powder
• potency: ≥98 Heavy amino acids incorporation efficiency by MS
• technique(s): mass spectrometry (MS): suitable
• suitability: suitable for mass spectrometry (standard)
• UniProt accession no.: P02452
• storage temp.: −20°C
• Gene Information: human ... COL1A1(1277)

Descripción

General description

Collagen type I is present in soft connective tissues and bone, where it constitutes more than 90% of the organic matrix.1 During bone formation collagen type I is synthesized from pro-collagen type I, which is secreted from fibroblasts and osteoblasts 2 Pro-collagen type I contains N-and C-terminal extensions, which are removed by specific proteases during the conversion of procollagen to collagen.3 Measurements of N- terminal propeptides of procollagen type I (PINP) can be of value in assessing bone formation.Recent evidence indicates that PINP can serve as a serum biomarker of bone formation, as it accurately identifies those patients who are responding to anabolic or antiresorptive therapy within 3 months of the start of treatment.4 The use of this biomarker in patients being treated for osteoporosis may significantly improve therapy adherence and clinical outcomes.4

Immunogen

QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPDYKDDDDKGHHHHHHHHGGQ

Biochem/physiol Actions

SILu^™Prot COL1A1 is a recombinant, stable isotope-labeled human COL1A1 which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of COL1A1 in mass-spectrometry. SILu Prot COL1A1 is a protein of 159 amino acids (Q23-P161 and including C-terminal polyhistidine and FLAG^® tags) with a calculated molecular mass of 16 kDa.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

FLAG is a registered trademark of Merck KGaA, Darmstadt, Germany

SILu is a trademark of Sigma-Aldrich Co. LLC

Información de seguridad

• Storage Class: 11 - Combustible Solids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable