AV49490
Anti-FAM20C (AB2) antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-DMP4, Anti-Family with sequence similarity 20, member C, Anti-RNS
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Productos recomendados
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
66 kDa
species reactivity
horse, rat, guinea pig, dog, mouse, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... FAM20C(56975)
General description
FAM20C (Family with sequence similarity 20, member C) is a member of FAM20 protein family. It is distributed in several mammalian cell lines. During hematopoietic differentiation, it is expressed in hematopoietic cells.
Immunogen
Synthetic peptide directed towards the C terminal region of human FAM20C
Application
Anti-FAM20C (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
FAM20C (Family with sequence similarity 20, member C) is a secretory Golgi casein kinase involved in biomineralization, enamel formation, lipid homeostasis, wound healing, cell migration and adhesion. It has ability to phosphorylate S-x-E/pS motifs on proteins present in milk and in the extracellular matrix of bones and teeth. During enamel formation, it forms a functional complex by binding to a pseudokinase, Fam20A, which triggers extracellular protein phosphorylation within the secretory pathway. Mutations in FAM20C gene cause Raine syndrome, hypophosphatemia, hyperphosphaturia, dental anomalies, intracerebral calcifications and osteosclerosis.
Sequence
Synthetic peptide located within the following region: NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Nan Miao et al.
International journal of molecular medicine, 43(5), 2103-2117 (2019-03-14)
Family with sequence similarity 20‑member C (FAM20C), a recently characterized Golgi kinase, performs numerous biological functions by phosphorylating more than 100 secreted proteins. However, the role of FAM20C in the salivary glands remains undefined. The present study demonstrated that FAM20C is mainly
Exome sequencing reveals FAM20c mutations associated with fibroblast growth factor 23-related hypophosphatemia, dental anomalies, and ectopic calcification.
Rafaelsen SH, et al.
Bone and Mineral, 28, 1378-1385 (2013)
Demet Nalbant et al.
BMC genomics, 6, 11-11 (2005-01-29)
Hematopoiesis is a complex developmental process controlled by a large number of factors that regulate stem cell renewal, lineage commitment and differentiation. Secreted proteins, including the hematopoietic growth factors, play critical roles in these processes and have important biological and
Hypophosphatemic osteomalacia and bone sclerosis caused by a novel homozygous mutation of the FAM20C gene in an elderly man with a mild variant of Raine syndrome.
Takeyari S, et al.
Bone, 67, 56-62 (2014)
Vincent S Tagliabracci et al.
Cell, 161(7), 1619-1632 (2015-06-20)
The existence of extracellular phosphoproteins has been acknowledged for over a century. However, research in this area has been undeveloped largely because the kinases that phosphorylate secreted proteins have escaped identification. Fam20C is a kinase that phosphorylates S-x-E/pS motifs on
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico