Synthetic peptide directed towards the C terminal region of human EBF2
Biochem/physiol Actions
EBF2 belongs to the EBF/COE family of transcription factors that contain well-conserved DNA-binding domain. EBF factors play important regulatory roles in various developmental processes and in differentiation of osteoblasts. EBF2 is critical in the generation and migration of Cajal-Retzius neurons during early cortical neurogenesis in cerebral cortex.
Sequence
Synthetic peptide located within the following region: VPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Cajal-Retzius (CR) cells play a crucial role in the formation of the cerebral cortex, yet the molecules that control their development are largely unknown. Here, we show that Ebf transcription factors are expressed in forebrain signalling centres-the septum, cortical hem
Mammalian cortical neurogenesis occurs on a precise time schedule during development. The earliest born neurons form the preplate and later separate into layer 1, which includes Cajal-Retzius (C-R) neurons, and the subplate. The preplate and its derivatives play a critical
Clinical cancer research : an official journal of the American Association for Cancer Research, 15(16), 5082-5091 (2009-08-13)
Osteosarcoma is the most prevalent bone tumor in children and adolescents. At present, the mechanisms of initiation, maintenance, and metastasis are poorly understood. The purpose of this study was to identify relevant molecular targets in the pathogenesis of osteosarcoma. Tumor
The Journal of neuroscience : the official journal of the Society for Neuroscience, 17(11), 4149-4158 (1997-06-01)
The Olf-1/EBF helix-loop-helix (HLH) transcription factor has been implicated in olfactory gene regulation and in B-cell development. Using homology screening methods, we identified two additional Olf-1/EBF-like cDNAs from a mouse embryonic cDNA library. The Olf-1/EBF-like (O/E) proteins O/E-1, O/E-2, and
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.