Skip to Content
MilliporeSigma
All Photos(7)

Key Documents

HPA002031

Sigma-Aldrich

Anti-MBD4 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Methyl-CpG-binding domain protein 4 antibody produced in rabbit, Anti-Methyl-CpG-binding endonuclease 1 antibody produced in rabbit, Anti-Methyl-CpG-binding protein MBD4 antibody produced in rabbit, Anti-Mismatch-specific DNA N-glycosylase antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$598.00

$598.00

Estimated to ship onMay 21, 2025

All Photos(7)

Select a Size

Change View
100 μL
$598.00

About This Item

MDL number:
MFCD05665239
UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA002031
NACRES:
NA.41

$598.00

Estimated to ship onMay 21, 2025

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

LQNQSNNSNWNLRTRSKCKKDVFMPPSSSSELQESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKGIPIKKTKKGCRKSCSGFVQSDSKRESVCNKADAESEPVAQKSQLDRTVCISDAGACGETLSVTSEEN

UniProt accession no.

O95243

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MBD4(8930)

Related Categories

General description

MBD4 (methyl-CpG binding domain 4, DNA glycosylase) is a methyl-CpG-binding endonuclease. It is a tripartite with an N-terminal 5-methylcytosine binding domain (MBD), a C-terminal catalytic domain with homology to bacterial DNA damage-specific glycosylases/lyases and a core region with five putative nuclear localization signals.

Immunogen

Methyl-CpG-binding domain protein 4 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

MBD4 (methyl-CpG binding domain 4, DNA glycosylase) is involved in the maintenance of genomic integrity. It acts as a DNA repair protein in the DNA mismatch repair (MMR) system. During DNA repair, MBD4 couples with MMR protein MLH1 (mutL homolog 1) that binds to the methyl-CpG-containing DNA to perform endonuclease activity. MBD4 also has impact on glycosylase/lyase activity in a pathway of base excision repair. It has been reported that mutation in MED1 activity may cause irregular DNA damage and tumor development.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86363

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
R04552
A06352
A006352
R004552

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A Bellacosa et al.
Proceedings of the National Academy of Sciences of the United States of America, 96(7), 3969-3974 (1999-03-31)
The DNA mismatch repair (MMR) is a specialized system, highly conserved throughout evolution, involved in the maintenance of genomic integrity. To identify novel human genes that may function in MMR, we employed the yeast interaction trap. Using the MMR protein
F Petronzelli et al.
The Journal of biological chemistry, 275(42), 32422-32429 (2000-08-10)
The human protein MED1 (also known as MBD4) was previously isolated in a two-hybrid screening using the mismatch repair protein MLH1 as a bait, and shown to have homology to bacterial base excision repair DNA N-glycosylases/lyases. To define the mechanisms

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service