WH0054578M3

Monoclonal Anti-UGT1A6 antibody produced in mouse

clone 4A10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-GNT1, Anti-HLUGP, Anti-HLUGP1, Anti-MGC29860, Anti-UDP glucuronosyltransferase 1 family, polypeptide A6, Anti-UDPGT, Anti-UGT1, Anti-UGT1*6, Anti-UGT1F
• MDL number: MFCD02262953
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4A10, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2aκ
• GenBank accession no.: NM_001072
• UniProt accession no.: P19224
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... UGT1A6(54578)

Description

General description

This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5′ exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5′ end of this gene results in two transcript variants. (provided by RefSeq)

Immunogen

UGT1A6 (NP_001063, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESK

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)