Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

MSST0033

Sigma-Aldrich

SILuProt COL1A1 N-terminal propeptide human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

Synonym(s):

Collagen alpha-1(I) chain, Collagenalpha-1(I)chain, P1NP

Sign Into View Organizational & Contract Pricing

Select a Size

10 μG
$742.00

$742.00


Check Cart for Availability

Request a Bulk Order

Select a Size

Change View
10 μG
$742.00

About This Item

UNSPSC Code:
23201100
NACRES:
NA.12

$742.00


Check Cart for Availability

Request a Bulk Order

biological source

human

Quality Level

recombinant

expressed in HEK 293 cells

assay

≥98% (SDS-PAGE)

form

lyophilized powder

potency

≥98 Heavy amino acids incorporation efficiency by MS

technique(s)

mass spectrometry (MS): suitable

suitability

suitable for mass spectrometry (standard)

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... COL1A1(1277)

General description

Collagen type I is present in soft connective tissues and bone, where it constitutes more than 90% of the organic matrix.1 During bone formation collagen type I is synthesized from pro-collagen type I, which is secreted from fibroblasts and osteoblasts 2 Pro-collagen type I contains N-and C-terminal extensions, which are removed by specific proteases during the conversion of procollagen to collagen.3 Measurements of N- terminal propeptides of procollagen type I (PINP) can be of value in assessing bone formation.Recent evidence indicates that PINP can serve as a serum biomarker of bone formation, as it accurately identifies those patients who are responding to anabolic or antiresorptive therapy within 3 months of the start of treatment.4 The use of this biomarker in patients being treated for osteoporosis may significantly improve therapy adherence and clinical outcomes.4

Immunogen

QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPDYKDDDDKGHHHHHHHHGGQ

Biochem/physiol Actions

SILuProt COL1A1 is a recombinant, stable isotope-labeled human COL1A1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of COL1A1 in mass-spectrometry. SILu Prot COL1A1 is a protein of 159 amino acids (Q23-P161 and including C-terminal polyhistidine and FLAG® tags) with a calculated molecular mass of 16 kDa.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
FLAG is a registered trademark of Merck KGaA, Darmstadt, Germany
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

11 - Combustible Solids

wgk_germany

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service