AV34976
Anti-GABRA1 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-γ-Aminobutyric acid (GABA) A receptor, α 1
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$466.00
$466.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
A recombinant, preservative-free antibody is available for your target. Try ZRB1626
All Photos(1)
Select a Size
Change View
100 μL
$466.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$466.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
A recombinant, preservative-free antibody is available for your target. Try ZRB1626
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
52 kDa
species reactivity
rabbit, bovine, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GABRA1(2554)
General description
GABRA1 codes for an alpha subunit of the gamma-aminobutyric acid (GABA) A receptor. Genetic alterations in GABRA1 have been linked to juvenile myoclonic epilepsy, bipolar disorders and Dravet syndrome.
Rabbit Anti-GABRA1 antibody recognizes canine, bovine, human, mouse, and rat GABRA1.
Rabbit Anti-GABRA1 antibody recognizes canine, bovine, human, mouse, and rat GABRA1.
Immunogen
Synthetic peptide directed towards the N terminal region of human GABRA1
Application
Rabbit Anti-GABRA1 antibody is suitable for western blot applications at 0.5 μg/ml.
Biochem/physiol Actions
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
Sequence
Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
recommended
Storage Class
10 - Combustible liquids
wgk_germany
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Yasue Horiuchi et al.
Biological psychiatry, 55(1), 40-45 (2004-01-07)
The gamma-aminobutyric acid (GABA) neurotransmitter system has been implicated in the pathogenesis of mood disorders. The GABRA1 gene encodes one of the subunits of GABA-A receptor and is located on human chromosome 5q34-q35, which is a region reportedly linked to
Patrick Cossette et al.
Nature genetics, 31(2), 184-189 (2002-05-07)
Although many genes that predispose for epilepsy in humans have been determined, those that underlie the classical syndromes of idiopathic generalized epilepsy (IGE) have yet to be identified. We report that an Ala322Asp mutation in GABRA1, encoding the alpha1 subunit
Gemma L Carvill et al.
Neurology, 82(14), 1245-1253 (2014-03-14)
To determine the genes underlying Dravet syndrome in patients who do not have an SCN1A mutation on routine testing. We performed whole-exome sequencing in 13 SCN1A-negative patients with Dravet syndrome and targeted resequencing in 67 additional patients to identify new
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
