AV34727
Anti-KEAP1 (AB1) antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Kelch-like ECH-associated protein 1
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$493.00
$493.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
All Photos(3)
Select a Size
Change View
100 μL
$493.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$493.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
70 kDa
species reactivity
human, rabbit, dog, rat, bovine, horse, pig, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... KEAP1(9817)
General description
KEAP1 codes for a KELCH-1 like domain-containing protein that interacts with NF-E2-related factor 2. KEPAP1 has been implicated in cell signaling pathways that regulate responses to environmental and oxidative stresses.
Rabbit Anti-KEAP1 antibody recognizes pig, zebrafish, canine, bovine, human, mouse, and rat KEAP1.
Rabbit Anti-KEAP1 antibody recognizes pig, zebrafish, canine, bovine, human, mouse, and rat KEAP1.
Immunogen
Synthetic peptide directed towards the N terminal region of human KEAP1
application
Rabbit Anti-KEAP1 antibody is suitable for western blot (0.5 μg/ml) applications.
Biochem/physiol Actions
KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.
Sequence
Synthetic peptide located within the following region: SQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNEL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Thomas W Kensler et al.
Annual review of pharmacology and toxicology, 47, 89-116 (2006-09-14)
Keap1-Nrf2-ARE signaling plays a significant role in protecting cells from endogenous and exogenous stresses. The development of Nrf2 knockout mice has provided key insights into the toxicological importance of this pathway. These mice are more sensitive to the hepatic, pulmonary
Akira Kobayashi et al.
Molecular and cellular biology, 24(16), 7130-7139 (2004-07-30)
Transcription factor Nrf2 is a major regulator of genes encoding phase 2 detoxifying enzymes and antioxidant stress proteins in response to electrophilic agents and oxidative stress. In the absence of such stimuli, Nrf2 is inactive owing to its cytoplasmic retention
Xuedan Nie et al.
Molecular medicine reports, 19(2), 1139-1149 (2018-12-12)
The neurological disorders and neural pathology brought about by chronic alcoholism are difficult to be reversed. Increasing evidence highlights the protective roles of erythropoietin (EPO) in neurodegenerative diseases and injuries of the central nervous system. In the present study, we
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
