Rabbit polyclonal anti-TRH antibody reacts with zebrafish, human, canine, chicken, and bovine thyrotrophin-releasing hormones.
Thyrotropin-releasing hormone/thyrotropin-releasing factor (TRH, TRF) is a tripeptidal hormone that stimulates the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary. TRH is a highly specific regulator of the thyrotropin-stimulating hormone (TSHβ) gene expression in the pituitary via a nerve growth factor IB (NGFIB, NR4A1, Nur77)/PKC/ERK1/2 pathway.
Immunogen
Synthetic peptide directed towards the C terminal region of human TRH
Application
Rabbit polyclonal anti-TRH antibody is used to tag thyrotrophin-releasing hormone for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of thyrotrophin-releasing hormone in the regulation of the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary. Anti-TRH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Sequence
Synthetic peptide located within the following region: RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
