CARD12 is an apoptotic protein that activates caspase-1. Rabbit Anti-CARD12 antibody binds to human, mouse and rat CARD12.
Immunogen
Synthetic peptide directed towards the C terminal region of human NLRC4
Application
Rabbit Anti-CARD12 antibody can be used for immunohistochemical (4-8μg/ml, using paraffin embedded tissues) and western blot (1μg/ml) applications.
Sequence
Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Biochemical and biophysical research communications, 284(1), 77-82 (2001-05-26)
The CED4/Apaf-1 family of proteins functions as critical regulators of apoptosis and NF-kappaB signaling pathways. A novel human member of this family, called CARD12, was identified that induces apoptosis when expressed in cells. CARD12 is most similar in structure to
Biochemical and biophysical research communications, 331(4), 1114-1119 (2005-05-11)
CARD12 (Ipaf/Clan) is an important regulator of caspase-1 activation. It belongs to the family of the nucleotide-binding site and leucine-rich repeat (NBS-LRR) proteins. The NBS domain of the NBS-LRR proteins contains putative ATP/GTPase-specific P-loop and Mg2+-binding site motifs. However, the
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
