Skip to Content
MilliporeSigma
All Photos(7)

Key Documents

AMAB90565

Sigma-Aldrich

Monoclonal Anti-PCM1 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL0206, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(s):

PTC4

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$555.00

$555.00


Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
$555.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.43

$555.00


Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL0206, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 1 μg/mL
immunohistochemistry: 1:200- 1:500

isotype

IgG1

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PCM1(5108)

General description

Pericentriolar material 1 (PCM1) gene codes for a 228 kDa protein. It has various coiled-coil domains in its amino-terminal. It is located in the cytoplasmic granules and is termed as centriolar satellites. PCM1 is located on human chromosome 8p22.

Immunogen

pericentriolar material 1 recombinant protein epitope signature tag (PrEST)

Sequence
TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFE

Epitope
Binds to an epitope located within the peptide sequence RQRALYALQD as determined by overlapping synthetic peptides.

Biochem/physiol Actions

Pericentriolar material 1 (PCM1) plays a major role in the development of cell cycle. It maintains the centrosome integrity and controls the microtubule cytoskeleton. PCM1 plays a vital role in the progression of the nervous system and neuronal activity. This protein participates in the enrolment of GABARAP (γ-aminobutyric acid receptor-associated protein) to the pericentriolar material.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76188

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Centriolar satellites control GABARAP ubiquitination and GABARAP-mediated autophagy.
Joachim J, et al.
Current Biology, 27(14), 2123-2136 (2017)
The t (8; 9)(p22; p24) translocation in atypical chronic myeloid leukaemia yields a new PCM1-JAK2 fusion gene.
Bousquet M, et al.
Oncogene, 24(48), 7248-7248 (2005)
Hugh M D Gurling et al.
Archives of general psychiatry, 63(8), 844-854 (2006-08-09)
There is evidence of linkage to a schizophrenia susceptibility locus on chromosome 8p21-22 found by several family linkage studies. To fine map and identify a susceptibility gene for schizophrenia on chromosome 8p22 and to investigate the effect of this genetic
Martina Wirth et al.
Nature communications, 10(1), 2055-2055 (2019-05-06)
Autophagy is an essential recycling and quality control pathway. Mammalian ATG8 proteins drive autophagosome formation and selective removal of protein aggregates and organelles by recruiting autophagy receptors and adaptors that contain a LC3-interacting region (LIR) motif. LIR motifs can be

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service