Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

WH0055288M1

Sigma-Aldrich

Monoclonal Anti-RHOT1 antibody produced in mouse

clone 4H4, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-ARHT1, Anti-FLJ11040, Anti-FLJ12633, Anti-MIRO1, Anti-ras homolog gene family, member T1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4H4, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RHOT1(55288)

Catégories apparentées

Description générale

Ras homolog family member T1 (RHOT1) is encoded by the gene mapped to human chromosome 17q11.2. RhoT1 is a member of mitochondrial Rho GTPase family.

Immunogène

RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP

Actions biochimiques/physiologiques

Ras homolog family member T1 (RHOT1) plays an essential role in controlling mitochondrial homeostasis and apoptosis. RHOT1 serves as a tumor suppressor gene for pancreatic cancer (PC), and it can be considered as a potential prognostic biomarker for overall survival and as a promising therapeutic target for PC. Decreased expression of RHOT1 might result in lymph node metastasis (LNM) and shorter survival. RHOT1 has a crucial role to play in mitochondrial transport, lymphocyte migration, and polarity.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Pei-I Tsai et al.
Molecular biology of the cell, 28(24), 3471-3479 (2017-09-15)
MIC60/mitofilin constitutes a hetero-oligomeric complex on the inner mitochondrial membranes to maintain crista structure. However, little is known about its physiological functions. Here, by characterizing
Renu Bajaj et al.
Molecular cytogenetics, 4, 3-3 (2011-01-22)
To evaluate the clinical validity of genome-wide oligonucleotide array comparative genomic hybridization (aCGH) for detecting somatic abnormalities, we have applied this genomic analysis to 30 cases (13 MDS and 17 AML) with clonal chromosomal abnormalities detected in more than 50%
Hua Jiang et al.
PloS one, 7(7), e42234-e42234 (2012-08-04)
Cancer cell invasion and metastasis are the most important adverse prognostic factors for pancreatic cancer. Identification of biomarkers associated with outcome of pancreatic cancer may provide new approaches and targets for anticancer therapy. The aim of this study is to
Annekathrin Moller et al.
Human molecular genetics, 26(23), 4668-4679 (2017-10-04)
Defective axonal transport is an early neuropathological feature of amyotrophic lateral sclerosis (ALS). We have previously shown that ALS-associated mutations in Cu/Zn superoxide dismutase 1 (SOD1) impair axonal transport of mitochondria in motor neurons isolated from SOD1 G93A transgenic mice
Jinshan Qin et al.
Nature communications, 11(1), 4471-4471 (2020-09-10)
A human cell contains hundreds to thousands of mitochondrial DNA (mtDNA) packaged into nucleoids. Currently, the segregation and allocation of nucleoids are thought to be passively determined by mitochondrial fusion and division. Here we provide evidence, using live-cell super-resolution imaging

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique