Accéder au contenu
Merck
Toutes les photos(2)

Documents

HPA023861

Sigma-Aldrich

Anti-AFMID antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonyme(s) :

Anti-KF, Anti-Kynurenine formamidase, Anti-Probable arylformamidase

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA023861
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

recombinant expression
Learn more about Antibody Enhanced Validation

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Séquence immunogène

VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD

Numéro d'accès UniProt

Q63HM1

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... AFMID(125061)

Catégories apparentées

Description générale

AFMID, kynurenine formamidase also called arylformamidase, is located on human chromosome 17q25.3. AFMID catalyses the hydrolysis of NFK (N-formyl-L-kynurenine) to kynurenine.

Immunogène

Probable arylformamidase recombinant protein epitope signature tag (PrEST)

Application

Anti-AFMID antibody produced in rabbit may be used for the detection of AFMID protein in western blotting.

Actions biochimiques/physiologiques

The conversion of tryptophan to nicotinic acid is catalysed by kynurenine formamidase. Alternative splicing in kynurenine formamidase gene modulates tumor suppressor p53 role in hepatocellular carcinoma development and progression. Indoleamine 2,3-dioxygenase-mediated kynurenine formation could play a role in cataract formation related to chronic inflammation.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST75936

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Kynurenine formamidase: determination of primary structure and modeling-based prediction of tertiary structure and catalytic triad1
Pabarcus MK and Casida JE
Biochimica et Biophysica Acta, Protein Structure and Molecular Enzymology, 1596(2), 201-211 (2002)
A human-specific switch of alternatively spliced AFMID isoforms contributes to TP53 mutations and tumor recurrence in hepatocellular carcinoma
Lin KT, et al.
Genome Research, 28, 275-284 (2018)
Induction of indoleamine 2, 3-dioxygenase by interferon-gamma in human lens epithelial cells: apoptosis through the formation of 3-hydroxykynurenine
Mailankot M and Nagaraj RH
The International Journal of Biochemistry & Cell Biology, 42(9), 1446-1454 (2010)
Qian Han et al.
The Biochemical journal, 446(2), 253-260 (2012-06-14)
KFase (kynurenine formamidase), also known as arylformamidase and formylkynurenine formamidase, efficiently catalyses the hydrolysis of NFK (N-formyl-L-kynurenine) to kynurenine. KFase is the second enzyme in the kynurenine pathway of tryptophan metabolism. A number of intermediates formed in the kynurenine pathway

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique