SAB1405052

Monoclonal Anti-ANAPC2, (C-terminal) antibody produced in mouse

clone 7F2, purified immunoglobulin, buffered aqueous solution

• Synonym(s): APC2, RP11-350O14.5
• UNSPSC Code: 12352203
• NACRES: NA.41
• conjugate: unconjugated
• application: ELISA (i); WB
• clone: 7F2, monoclonal
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 7F2, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.88 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: NM_013366
• UniProt accession no.: Q9UJX6
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ANAPC2(29882)

Description

General description

A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The product of this gene is a component of the complex and shares sequence similarity with a recently identified family of proteins called cullins, which may also be involved in ubiquitin-mediated degradation. (provided by RefSeq)

Immunogen

ANAPC2 (NP_037498, 716 a.a. ~ 822 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable