HPA008192

Anti-TBX20 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-T-box protein 20, Anti-T-box transcription factor TBX20
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA008192

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: suitable
• secuencia del inmunógeno: DSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSS
• Nº de acceso UniProt: Q9UMR3
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TBX20(57057)

Descripción

Descripción general

T-box transcription factor (TBX20) belongs to the T-box transcription factor family. It is expressed in the developing hearts of embryos in vertebrates and invertebrates. TBX20 contains a DNA-binding domain called the T-box domain and the gene encoding this protein is present on chromosome 7p14-p15.

Inmunógeno

T-box transcription factor TBX20 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-TBX20 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Acciones bioquímicas o fisiológicas

T-box transcription factor (TBX20) activates cardiac gene expression by interacting with transcription factors NK2 homeobox 5 (Nkx2-5), GATA binding protein 4 (GATA4) and GATA binding protein 5 (GATA5). During endocardial differentiation, it specifically interacts with GATA5. TBX20 and other T-box genes and factors interact repressively. This is responsible for splitting of the myocardium into the chamber and non-chamber. It is an important event upon which all the subsequent morphogenesis activities depend. Based on the particular isoform expressed and cellular requirements, TBX20 can regulate transcription of target genes both positively and negatively. Its T-box DNA-binding domain associates specifically with the consensus DNA half site sequence defined for the brachyury (T) protein. TBX20 also interacts with homeodomain factor Nkx2-5 and zinc finger factor GATA4.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST70963.

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)