Saltar al contenido
MilliporeSigma
Todas las fotos(2)

Documentos clave

AV47083

Sigma-Aldrich

Anti-KIAA0319 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-DLX2, Anti-DYLX2, Anti-DYX2, Anti-KIAA0319, Anti-MGC176717

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

56 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... KIAA0319(9856)

Categorías relacionadas

Inmunógeno

Synthetic peptide directed towards the N terminal region of human KIAA0319

Aplicación

Anti-KIAA0319 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Acciones bioquímicas o fisiológicas

KIAA0319 gene encodes a single-pass type I membrane protein primarily expressed in brain cortex, putamen, amygdala, hippocampus and cerebellum. It plays a crucial role in regulating neuronal migration and cell adhesion and hence facilitates the development of cerebral cortex. KIAA0319 may also regulate the growth and differentiation of dendrites.

Secuencia

Synthetic peptide located within the following region: EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Silvia Paracchini et al.
Human molecular genetics, 15(10), 1659-1666 (2006-04-08)
Dyslexia is one of the most prevalent childhood cognitive disorders, affecting approximately 5% of school-age children. We have recently identified a risk haplotype associated with dyslexia on chromosome 6p22.2 which spans the TTRAP gene and portions of THEM2 and KIAA0319.
Veronica J Peschansky et al.
Cerebral cortex (New York, N.Y. : 1991), 20(4), 884-897 (2009-08-15)
We investigated the postnatal effects of embryonic knockdown and overexpression of the candidate dyslexia gene homolog Kiaa0319. We used in utero electroporation to transfect cells in E15/16 rat neocortical ventricular zone with either 1) small hairpin RNA (shRNA) vectors targeting

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico