Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

AV39504

Sigma-Aldrich

Anti-PRDM12 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-PR domain containing 12

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$457.00

$457.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μL
$457.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

$457.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

40 kDa

reactividad de especies

rat, human, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PRDM12(59335)

Descripción general

PR domain proteins (PRDM) are a small family of kruppel-like zinc finger transcription factors involved in cell differentiation and tumorigenesis. PR domain containing 12 (PRDM12) is a putative tumor suppressor that may be implicated in poor outcome chronic myeloid leukemia (CML).

Especificidad

Anti-PRDM12 polyclonal antibody reacts with zebrafish, human, mouse, rat, and bovine PR domain containing 12 proteins.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human PRDM12

Aplicación

Anti-PRDM12 polyclonal antibody is used to tag PR domain containing 12 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of PR domain containing 12 protein in cell differentiation and tumorigenesis such as chronic myeloid leukemia.

Acciones bioquímicas o fisiológicas

PRDM12 belongs to PR-domain family which are involved in human cancers in an unusual yin-yang fashion. Two products are normally produced from a PR-domain family member which differ by the presence or absence of the PR domain; the PR-plus product is disrupted or underexpressed whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, a result of either genetic or epigenetic events, appears to be an important cause of malignancy. PRDM12 may have a potential role in the pathogenesis of chronic myeloid leukaemia with derivative chromosome 9 deletion.

Secuencia

Synthetic peptide located within the following region: NHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPAL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico