Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

WH0001785M1

Sigma-Aldrich

Monoclonal Anti-DNM2 antibody produced in mouse

clone 6C9, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DYN2, Anti-DYNII, Anti-dynamin 2

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6C9, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... DNM2(1785)

General description

Dynamins represent one of the subfamilies of GTP-binding proteins. These proteins share considerable sequence similarity over the N-terminal portion of the molecule, which contains the GTPase domain. Dynamins are associated with microtubules. They have been implicated in cell processes such as endocytosis and cell motility, and in alterations of the membrane that accompany certain activities such as bone resorption by osteoclasts. Dynamins bind many proteins that bind actin and other cytoskeletal proteins. Dynamins can also self-assemble, a process that stimulates GTPase activity. Four alternatively spliced transcripts encoding different proteins have been described. Additional alternatively spliced transcripts may exist, but their full-length nature has not been determined. (provided by RefSeq)

Immunogen

DNM2 (AAH54501, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESAD

Biochem/physiol Actions

DNM2 (dynamin 2) is a GTPase which is required for clathrin-mediated endocytosis. It is important for clathrin-coated pit maturation and clathrin-coated vesicle formation. DNM2 participates in neuronal morphology, axonal growth, centrosome cohesion, actin- and microtubular organization. Mutations in it are associated with Charcot-Marie-Tooth disease, centronuclear myopathy ADCNM (autosomal dominant centronuclear myopathy) and lethal congenital contractures syndrome type 5 (LCCS5). It is upregulated in prostate cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Bin Xu et al.
Cancer medicine, 3(1), 14-24 (2014-01-10)
Dynamin 2 (Dyn2) is essential for intracellular vesicle formation and trafficking, cytokinesis, and receptor endocytosis. In this study, we investigated the implication of Dyn2 as a prognostic marker and therapeutic target for progressive prostate cancer (PCA). We evaluated Dyn2 protein
Nyamkhishig Sambuughin et al.
BMC neurology, 15, 223-223 (2015-11-01)
Hereditary Spastic Paraplegia (HSP) represents a large group of clinically and genetically heterogeneous disorders linked to over 70 different loci and more than 60 recognized disease-causing genes. A heightened vulnerability to disruption of various cellular processes inherent to the unique

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service