Synthetic peptide directed towards the N terminal region of human GSR
Biochem/physiol Actions
GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.
Sequence
Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Frontiers in physiology, 12, 649793-649793 (2021-05-14)
The mdx mouse phenotype aggravated by chronic exercise on a treadmill makes this murine model more reliable for the study of muscular dystrophy. Thus, to better assess the Tempol effect on dystrophic pathways, the analyses in this study were performed
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
