Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

SAB2100330

Sigma-Aldrich

Anti-CACNB2 (ab1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Calcium channel, voltage-dependent, β 2 subunit, Anti-FLJ23743, Anti-MYSB

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

68 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CACNB2(783)

General description

Calcium voltage-gated channel auxiliary subunit beta 2 (CACNB2) is a part of voltage-gated calcium channel gene superfamily and encodes Cavβ2 subunit. In human chromosome, the gene CACNB2 is localized on 10p12.33-p12.31.

Immunogen

Synthetic peptide directed towards the middle region of human CACNB2

Biochem/physiol Actions

CACNB2 contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. Defects in CACNB2 are the cause of Brugada syndrome type 4 (BRS4). CACNB2 is associated with systolic blood pressure and hypertension. Downregulation of CACNB2 expression leads to atrial fibrillation. Mutations in CACNB2 causes dysregulation of calcium levels in cells leading to autism spectrum disorder. Single nucleotide polymorphism in CACNB2 gene is associated with bipolar disorder and schizophrenia.

Sequence

Synthetic peptide located within the following region: HLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The dark side of the QT interval. The Short QT Syndrome: pathophysiology, clinical presentation and management
Comelli I, et al.
Emergency Care Journal, 8(3), 41-47 (2012)
Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis
Smoller JW
Lancet, 381(9875), 1371-1379 (2013)
Regulation of cardiac CACNB2 by microRNA-499: Potential role in atrial fibrillation
Ling TY, et al.
BBA Clinical, 7(9875), 78-84 (2017)
Alexandra F S Breitenkamp et al.
PloS one, 9(4), e95579-e95579 (2014-04-23)
Autism Spectrum Disorders (ASD) are complex neurodevelopmental diseases clinically defined by dysfunction of social interaction. Dysregulation of cellular calcium homeostasis might be involved in ASD pathogenesis, and genes coding for the L-type calcium channel subunits CaV1.2 (CACNA1C) and CaVβ2 (CACNB2)
Yinghua Lin et al.
Atherosclerosis, 219(2), 709-714 (2011-10-04)
Two large-scale genome-wide association studies (GWAs) have identified multiple variants associated with blood pressure (BP) or hypertension. The present study was to investigate whether some variations were associated with BP traits and hypertension or even prehypertension in adult She ethnic

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service