SAB1409253

Monoclonal Anti-INSRR antibody produced in mouse

clone 2C1, purified immunoglobulin, buffered aqueous solution

• Synonym(s): IRR
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2C1, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 37.73 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: NM_014215
• UniProt accession no.: P14616
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... INSRR(3645)

Description

General description

The gene INSRR (insulin receptor related receptor) is mapped to human chromosome 1q21-q23. It belongs to the insulin receptor family of proteins. INSRR is mainly present in organs which are associated with acid/base generation. The protein has two N-terminal leucine-rich repeat domains, a cysteine-rich C domain and three C-terminal fibronectin type-III repeats.

Immunogen

INSRR (NP_055030, 651 a.a. ~ 760 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF

Biochem/physiol Actions

INSRR (insulin receptor related receptor) exhibits pH-sensing property and is a sensor for mild alkaline extracellular medium. In mice, it is associated with excessive excretion of base by the kidneys.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable