SAB1403845

Monoclonal Anti-FZD2 antibody produced in mouse

clone 1E7, purified immunoglobulin, buffered aqueous solution

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1E7, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~32.05 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable
• isotype: IgG2bκ
• NCBI accession no.: NM_001466
• UniProt accession no.: Q14332
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FZD2(2535)

Description

General description

Members of the ′frizzled′ gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The expression of the FZD2 gene appears to be developmentally regulated, with high levels of expression in fetal kidney and lung and in adult colon and ovary. (provided by RefSeq)

Immunogen

FZD2 (NP_001457, 192 a.a. ~ 245 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable