SAB1402456

Monoclonal Anti-OSMR antibody produced in mouse

clone 3E12, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MGC150626, MGC150627, MGC75127, OSMRB
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3E12, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• NCBI accession no.: NM_003999
• UniProt accession no.: Q99650
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... OSMR(9180)

Description

General description

Oncostatin M receptor (OSMR) is a cell surface cytokine receptor. Oncostatin M and interleukin-31 are its ligands. The gene encoding this protein is localized on human chromosome 5p.

Immunogen

OSMR (NP_003990.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP

Biochem/physiol Actions

Oncostatin M receptor (OSMR) acts as an activator of janus kinase/signal transducers and activators of transcription (JAK/STAT) and mitogen-activated protein kinase pathway. Thus, it has a role in stimulating cytokines and inflammatory substances. Mutation in the OSMR gene has been linked to primary localized cutaneous amyloidosis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable