HPA037837
Anti-IPMK antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-Inositol polyphosphate multikinase
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunogen sequence
DCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSD
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... IPMK(253430)
General description
The gene encoding inositol polyphosphate multikinase (IPMK) enzyme is located on human chromosome 10q21.1. IPMK consists of inositol phosphate binding, nuclear localization signal, and ATP-binding kinase domain. It is a catalytically flexible enzyme and is part of intracellular signalling network.
Immunogen
inositol polyphosphate multikinase recombinant protein epitope signature tag (PrEST)
Application
Anti-IPMK antibody produced in rabbit may be used for the detection of IPMK protein in
- lymphoblasts by immunoprecipitation
- human adenocarcinogenic cell lines by western blotting
- in mouse 3T3 cells by western blotting
Biochem/physiol Actions
Inositol polyphosphate multikinase (IPMK) indirectly mediates mRNA transport from nucleus to cytoplasm by mediating synthesis of phosphatidylinositol levels. IPMK interacts and stabilizes tumor necrosis factor receptor in HEK293T cells.IPMK coordinates with various signaling networks. Its deletion impairs immune response signalling pathways. Knockdown of IPMK leads to imbalance in the inositol polyphosphates. IPMK binds to tumor suppressor protein and regulates transcription and cell death. Mutation in the IPMK gene results in a truncated protein with reduced kinase activity. IPMK gene deletion or RNA interference results in cell growth inhibition. IPMK is regarded as prime target for tumor suppression. Pathology of Huntington′s disease is associated with IPMK protein depletion. In Alzheimer′s patients, low IPMK transcript levels may play a key in neurodegeneration.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST80294
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
The human homologue of yeast ArgRIII protein is an inositol phosphate multikinase with predominantly nuclear localization
Nalaskowski MM, et al.
The Biochemical Journal, 366(2), 549-556 (2002)
Oisun Jung et al.
The EMBO journal, 43(9), 1740-1769 (2024-04-03)
The Hippo pathway effectors Yes-associated protein 1 (YAP) and its homolog TAZ are transcriptional coactivators that control gene expression by binding to TEA domain (TEAD) family transcription factors. The YAP/TAZ-TEAD complex is a key regulator of cancer-specific transcriptional programs, which
The human homolog of the rat inositol phosphate multikinase is an inositol 1, 3, 4, 6-tetrakisphosphate 5-kinase
Chang , et al.
The Journal of Biological Chemistry, 277(46), 43836-43843 (2002)
Structural features of human inositol phosphate multikinase rationalize its inositol phosphate kinase and phosphoinositide 3-kinase activities.
Wang H and Shears SB
The Journal of Biological Chemistry, jbc-M117 (2017)
Huntington?s disease: Neural dysfunction linked to inositol polyphosphate multikinase
Ahmed I, et al.
Proceedings of the National Academy of Sciences of the USA, 112(31), 9751-9756 (2015)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service