Skip to Content
MilliporeSigma
All Photos(6)

Documents

HPA008237

Sigma-Aldrich

Anti-OXSR1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Oxidative stress-responsive 1 protein antibody produced in rabbit, Anti-Serine/threonine-protein kinase OSR1 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing
All Photos(6)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA008237
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

FDEESEEGKAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDIRFE

UniProt accession no.

O95747

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... OXSR1(9943)

General description

Oxidative stress responsive 1 (OXSR1) is a 58kDa protein having 527 amino acids. It belongs to the Ste20p family of proteins which are serine/threonine-protein kinases. OXSR1 is expressed in mammalian tissues and cell lines.

Immunogen

Serine/threonine-protein kinase OSR1 recombinant protein epitope signature tag (PrEST)

application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Oxidative stress responsive 1 (OXSR1) phosphorylates the threonine-84 residue in the amino-terminal regulatory domain of the p21-activated protein kinase (PAK1), thereby modulating the G protein sensitivity of PAK1. It also regulates and modulates the activities of PAK2 and PAK3. The carboxyl-terminus of OXSR1 binds to gelsolin, an actin-binding protein. It associates with growing ends of actin filaments and nucleates actin assembly. Thus, OXSR1 regulates the actin cytoskeleton. It also interacts with and phosphorylates three RELT (Receptor expressed in lymphoid tissues) family members, RELT, RELL2 (RELT-like protein 2) and RELL1 which are involved in tumor necrosis factor (TNF) receptor mediated pathway.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71456

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Wei Chen et al.
The Journal of biological chemistry, 279(12), 11129-11136 (2004-01-07)
In examining the protein kinase components of mitogen-activated protein (MAP) kinase (MAPK) cascades that regulate the c-Jun N-terminal kinase (JNK) in Drosophila S2 cells, we previously found that distinct upstream kinases were involved in responses to sorbitol and lipopolysaccharide. Here
John K Cusick et al.
Biochemical and biophysical research communications, 340(2), 535-543 (2006-01-04)
RELL1 and RELL2 are two newly identified RELT homologues that bind to the TNF receptor family member RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues. RELT

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service