Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

HPA005436

Sigma-Aldrich

Anti-CC2D1A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Coiled-coil and C2 domain-containing protein 1A antibody produced in rabbit, Anti-FRE under dual repression-binding protein 1 antibody produced in rabbit, Anti-Five repressor element under dual repression-binding protein 1 antibody produced in rabbit, Anti-Freud-1 antibody produced in rabbit, Anti-Putative NF-κ-B-activating protein 023N antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50-1:200
western blot: 0.04-0.4 μg/mL

immunogen sequence

NLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CC2D1A(54862)

General description

Coiled-coil and C2 domain containing 1A (CC2D1A) gene codes for a signaling scaffold, which has multiple functions. It is also called Freud-1 (Five prime REpressor Under Dual repression binding protein 1), and belongs to CC2D1A gene family, which also contains the homologous gene CC2D1B/Freud-2. CC2D1A is expressed in cytosol, centrosome and nucleus and is also known as Akt kinase-interacting protein 1 (Aki1). The CC2D1A family consists of a DM14 domain, a C2 domain and two conserved motifs. CC2D1A gene is localized to the chromosomal region 19p13.12.

Immunogen

Coiled-coil and C2 domain-containing protein 1A recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

CC2D1A (Coiled-coil and C2 domain containing 1A) protein plays an important role in nuclear factor κB (NF-κB) pathway as well as pathways involving protein kinase B (PKB). It also mediates intracellular trafficking and neuronal differentiation. This protein has a long and a short isoform, and the long isoform is the major isoform involved in the regulation, expression and localization of the 5-HT1A receptor gene. It acts as a scaffold in the phosphoinositide 3-kinase (PI3K)/3-phosphoinositide-dependent protein kinase 1 (PDK1)/Akt pathway, when present in the cytosol. During mitosis, CC2D1A helps centriole cohesion by mediating the spindle pole localization of cohesin subunit Scc1. It also regulates cell survival by interacting with Epidermal Growth Factor (EGF), and thus inducing AKT phosphorylation. Mutations in this gene have been linked to non-syndromic mental retardation (NSMR). In humans, CC2D1A plays a supposed role in development of cognitive functions.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70744

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

F Lucy Raymond et al.
Human molecular genetics, 15 Spec No 2, R110-R116 (2006-09-22)
Genetic abnormalities frequently give rise to a mental retardation phenotype. Recent advances in resolution of comparative genomic hybridization and genomic sequence annotation has identified new syndromes at chromosome 3q29 and 9q34. The finding of a significant number of copy number
M Chiara Manzini et al.
Cell reports, 8(3), 647-655 (2014-07-30)
Autism spectrum disorder (ASD) and intellectual disability (ID) are often comorbid, but the extent to which they share common genetic causes remains controversial. Here, we present two autosomal-recessive "founder" mutations in the CC2D1A gene causing fully penetrant cognitive phenotypes, including
Anastasia Rogaeva et al.
The European journal of neuroscience, 26(4), 965-974 (2007-08-24)
The CC2D1A/Freud-1 gene has recently been linked to non-syndromic mental retardation and a short isoform of mouse Five prime REpressor Under Dual repression binding protein 1 (Freud-1) can repress the serotonin-1A (5-HT1A) receptor gene in rodent cells. In this study
L Basel-Vanagaite et al.
Journal of medical genetics, 43(3), 203-210 (2005-07-22)
The molecular basis of autosomal recessive non-syndromic mental retardation (NSMR) is poorly understood, mostly owing to heterogeneity and absence of clinical criteria for grouping families for linkage analysis. Only two autosomal genes, the PRSS12 gene on chromosome 4q26 and the
Anastasia Rogaeva et al.
Journal of neuroscience research, 85(13), 2833-2838 (2007-03-31)
The CC2D1A gene family consists of two homologous genes, Freud-1/CC2D1A and Freud-2/CC2D1B, that share conserved domains, including several DM14 domains that are specific to this protein family, a C-terminal helix-loop-helix domain, and a C2 calcium-dependent phospholipid binding domain. Although the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service