Skip to Content
MilliporeSigma
All Photos(1)

Documents

AV54307

Sigma-Aldrich

Anti-LIG1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Ligase I, DNA, ATP-dependent, Anti-MGC117397, Anti-MGC130025

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

102 kDa

species reactivity

guinea pig, rabbit, human, mouse, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LIG1(3978)

Immunogen

Synthetic peptide directed towards the middle region of human LIG1

Application

Anti-LIG1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

LIG1 gene encodes an enzyme that belongs to ATP-dependent DNA ligase protein family. The protein plays a crucial role in sealing the nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. Mutation or defects in LIG1 gene results in Bloom′s syndrome cells.

Sequence

Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rüveyda Dok et al.
International journal of cancer, 146(4), 1075-1085 (2019-07-10)
Radiotherapy is one of the most used treatment approaches for head and neck squamous cell carcinoma (HNSCC). Targeted inhibition of DNA repair machinery has the potential to improve treatment response by tailoring treatment to cancer cells lacking specific DNA repair
Mark R Taylor et al.
The Journal of biological chemistry, 286(26), 23054-23062 (2011-05-13)
DNA ligase I (LIG1) catalyzes the ligation of single-strand breaks to complete DNA replication and repair. The energy of ATP is used to form a new phosphodiester bond in DNA via a reaction mechanism that involves three distinct chemical steps:
Timothy R L Howes et al.
Sub-cellular biochemistry, 62, 327-341 (2012-08-25)
Multiple DNA ligation events are required to join the Okazaki fragments generated during lagging strand DNA synthesis. In eukaryotes, this is primarily carried out by members of the DNA ligase I family. The C-terminal catalytic region of these enzymes is
J H Petrini et al.
Proceedings of the National Academy of Sciences of the United States of America, 88(17), 7615-7619 (1991-09-01)
Alteration of DNA ligase I activity is a consistent biochemical feature of Bloom's syndrome (BS) cells. DNA ligase I activity in BS cells either is reduced and abnormally thermolabile or is present in an anomalously dimeric form. To assess the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service