Synthetic peptide directed towards the middle region of human PTPN1
application
Anti-PTPN1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
Protein tyrosine phosphatase, non-receptor type 1 (PTPN1) is the first member of protein tyrosine phosphatase (PTP) family to be identified. The members of this family are involved in cell growth, differentiation and mitosis. PTPN1 dephosphorylates insulin receptor, JAK2 and TYK2 kinases and negatively regulates cell signaling mediated by these proteins.
Sequence
Synthetic peptide located within the following region: SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Umbilical cord blood (CB) is a convenient and broadly used source of hematopoietic stem cells (HSCs) for allogeneic stem cell transplantation. However, limiting numbers of HSCs remain a major constraint for its clinical application. Although one feasible option would be
Protein tyrosine phosphatase 1B (PTPN1) dephosphorylates insulin receptors and attenuates insulin signaling. Polymorphisms in the coding sequence of PTPN1 have been variably associated with type 2 diabetes (T2D). We hypothesized that variations within the PTPN1 promoter might contribute to the
The Journal of biological chemistry, 276(51), 47771-47774 (2001-11-06)
The reversible tyrosine phosphorylation of proteins, modulated by the coordinated actions of protein-tyrosine kinases and protein-tyrosine phosphatases (PTPs), regulates the cellular response to a wide variety of stimuli. It is established that protein kinases possess discrete sets of substrates and
The Biochemical journal, 402(1), 1-15 (2007-01-24)
It is now well established that the members of the PTP (protein tyrosine phosphatase) superfamily play critical roles in fundamental biological processes. Although there has been much progress in defining the function of PTPs, the task of identifying substrates for
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
