Insulin gene enhancer protein, ISL-2, is a LIM homeobox domain transcription factor. Human ISL-2 is a 39 kDa protein found expressed in the nucleus of numerous cell types including motorneurons early in development of the spinal column.
Immunogen
Synthetic peptide directed towards the C terminal region of mouse ISL2
Biochem/physiol Actions
Isl2 specifies RGC laterality by repressing an ipsilateral pathfinding program unique to VTC RGCs and involving Zic2 and EphB1. This genetic hierarchy controls binocular vision.
Sequence
Synthetic peptide located within the following region: VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGTPLVAGSPIGH
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
LIM homeobox genes have a prominent role in the regulation of neuronal subtype identity and distinguish motor neuron subclasses in the embryonic spinal cord. We have investigated the role of Isl-class LIM homeodomain proteins in motor neuron diversification using mouse
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
