Comparison of Rat and Human Beta-Amyloid (11-40) sequence EVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - Rat, MW = 3170.74 EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - Human, MW = 3151.7
Product Source: E. coli
Application
Research Category Neuroscience
Research Sub Category Neurodegenerative Diseases
Physical form
White lyophilized powder. Resuspend in 1% NH4OH at a concentration of 1 mg/mL. Sonicate for 30 seconds to 1 minute after it has gone into solution. To bring into your solution: After resuspension, add 5x or 10x buffer stock (PBS, TBS) and water to bring to 1x buffer.
Storage and Stability
Maintain lyophilized material at -20°C for up to 12 months after date of receipt. After reconstitution maintain at -20°C to -70°C for up to 2 weeks in undiluted aliquots. Avoid freeze/thaw cycles to avoid aggregation.
Legal Information
CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Storage Class
11 - Combustible Solids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.