Skip to Content
Merck
All Photos(2)

Documents

WH0023057M1

Sigma-Aldrich

Monoclonal Anti-NMNAT2 antibody produced in mouse

clone 2E4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Nmnat2 Antibody, Nmnat2 Antibody - Monoclonal Anti-NMNAT2 antibody produced in mouse, Anti-C1orf15, Anti-KIAA0479, Anti-MGC2756, Anti-PNAT2, Anti-nicotinamide nucleotide adenylyltransferase 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2E4, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NMNAT2(23057)

General description

NMNAT2 (nicotinamide nucleotide adenylyltransferase 2) is a rate limiting enzyme that is located on human chromosome 1q25. It is expressed in the brain. Nmnat2 is located to vesicular structures.
This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

NMNAT2 (NP_055854, 208 a.a. ~ 307 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG

Application

Monoclonal Anti-NMNAT2 antibody has been used in immunoblotting.

Biochem/physiol Actions

NMNAT2 (nicotinamide nucleotide adenylyltransferase 2) plays a major role in cancer suppression. It may induce multiplication and prevent apoptosis in CRC (colorectal cancer) cells. NMNAT2 participates in energy metabolism. This protein helps to postpone axon degeneration.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rescue of peripheral and CNS axon defects in mice lacking NMNAT2
Gilley J, et al.
The Journal of Neuroscience, 33(33), 13410-13424 (2013)
Nmnat2 attenuates Tau phosphorylation through activation of PP2A
Cheng XS, et al.
Journal of Alzheimer'S Disease, 36(1), 185-195 (2013)
Decreased SMG7 expression associates with lupus-risk variants and elevated antinuclear antibody production
Annals of the Rheumatic Diseases, 75(11) (2016)
Nicotinamide Mononucleotide Adenylyl Transferase 2: A Promising Diagnostic and Therapeutic Target for Colorectal Cancer
Cui C, et al.
BioMed Research International, 2016 (2016)
Andrea Loreto et al.
Neurobiology of disease, 134, 104678-104678 (2019-11-20)
Wallerian degeneration of physically injured axons involves a well-defined molecular pathway linking loss of axonal survival factor NMNAT2 to activation of pro-degenerative protein SARM1. Manipulating the pathway through these proteins led to the identification of non-axotomy insults causing axon degeneration

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service