Skip to Content
Merck
All Photos(5)

Documents

HPA009065

Sigma-Aldrich

Anti-SOX7 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Transcription factor SOX-7

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

SPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLISVLADATATYYNSYS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SOX7(83595)

General description

SOX7 (Sex-determining region Y-box 7) is a transcription factor, which is a member of the SOX family. It belongs to the SOX F subgroup, which also contains SOX17 and SOX18. This gene is localized to human chromosome 8p23.1.

Immunogen

Transcription factor SOX-7 recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

SOX7 (Sex-determining region Y-box 7) is involved in multiple developmental events such as, hematopoiesis, endoderm differentiation, vasculogenesis, cardiogenesis and myogenesis. This gene is deleted in non-small cell lung cancer (NSCLC), and functions as a tumor suppressor in colorectal and prostate cancer. Only Sox7 is capable of transcriptionally elevating the expression of SOX4. However, this results in suppression of Sox4-meditated activation of β-catenin/TCF (transcription factor) 4-driven transcription. SOX7 also functions in a complex feedback loop where activation of SOX4 results in the inhibition of its own promoter activity. It functions as tumor suppressor through Wnt/β-catenin pathway, and inactivation in ovarian cancer leads to malignancy and tumor suppression. It suppresses hepatocarcinogenesis, and thus, might have potential as a therapeutic target.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70981

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Takahide Hayano et al.
Journal of experimental & clinical cancer research : CR, 32, 17-17 (2013-04-06)
SOX7 is a transcription factor belonging to the SOX family. Its role in lung cancer is unknown. In this study, whole genomic copy number analysis was performed on a series of non-small cell lung cancer (NSCLC) cell lines and samples
Huidi Liu et al.
Journal of ovarian research, 7, 87-87 (2014-10-10)
Products of the SOX gene family play important roles in the life process. One of the members, SOX7, is associated with the development of a variety of cancers as a tumor suppression factor, but its relevance with ovarian cancer was
Lu Wang et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 33(1), 254-263 (2018-06-30)
SOX7 (SRY-related high mobility group box 7), a high mobility group protein, is reported to be down-regulated in several cancer types, which indicates an important role in tumorigenesis; however, its biologic role in renal cell carcinoma (RCC) pathogenesis remains unknown.
Xuechao Jiang et al.
Clinical science (London, England : 1979), 135(6), 829-846 (2021-03-16)
The endothelial-to-mesenchymal transition (EndMT) is a critical process that occurs during the development of the outflow tract (OFT). Malformations of the OFT can lead to the occurrence of conotruncal defect (CTD). SOX7 duplication has been reported in patients with congenital
Makoto Saegusa et al.
Laboratory investigation; a journal of technical methods and pathology, 92(4), 511-521 (2012-01-11)
Sox factors function as either activators or repressors of β-catenin/TCF transcription depending on the cellular context and associated interacting proteins. Our previous study provided evidence that alteration in β-catenin signaling is an essential event during transdifferentiation toward the morular phenotype

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service