Skip to Content
Merck
All Photos(3)

Key Documents

HPA005690

Sigma-Aldrich

Anti-RNASE7 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-RNase 7 antibody produced in rabbit, Anti-Ribonuclease 7 precursor antibody produced in rabbit, Anti-SAP-2 antibody produced in rabbit, Anti-Skin-derived antimicrobial protein 2 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RNASE7(84659)

General description

Ribonuclease 7 (RNASE7) is a 14.5kDa protein belonging to the RNase A superfamily of ribonucleases. The gene encoding this protein is present on chromosome 14.

Immunogen

Ribonuclease 7 precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-RNASE7 antibody produced in rabbit is also suitable for enzyme-linked immunosorbent assay (ELISA).[1]
Anti-RNASE7 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Ribonuclease 7 (RNASE7) has a broad spectrum antimicrobial activity against many pathogenic microorganisms, especially Vancomycin-resistant Enterococcus faecium. There are 22 positively charged residues (Lysine and Arginine) which are distributed into three clusters on the surface of this enzyme. RNASE7 binds to bacterial membrane and makes the membrane permeable, with the help of the flexible and clustered Lys residues K1,K3,K111 and K112. The conformation of the enzyme can be adapted for pore formation for the disruption of bacterial membranes.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70448

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The flexible and clustered lysine residues of human ribonuclease 7 are critical for membrane permeability and antimicrobial activity.
YC Huang
The Journal of Biological Chemistry, 282(7), 4626-4633 (2007)
John David Spencer et al.
Kidney international, 83(4), 615-625 (2013-01-11)
The mechanisms that maintain sterility in the urinary tract are incompletely understood; however, recent studies stress the importance of antimicrobial peptides in protecting the urinary tract from infection. Ribonuclease 7 (RNase 7), a potent antimicrobial peptide contributing to urinary tract
Laura Schwartz et al.
Proceedings of the National Academy of Sciences of the United States of America, 120(4), e2213363120-e2213363120 (2023-01-19)
With the emergence of antibiotic-resistant bacteria, innovative approaches are needed for the treatment of urinary tract infections. Boosting antimicrobial peptide expression may provide an alternative to antibiotics. Here, we developed reporter cell lines and performed a high-throughput screen of clinically
RNase 7, a novel innate immune defense antimicrobial protein of healthy human skin.
J. Harder, JM. Schroder
The Journal of Biological Chemistry, 277(48), 46779-46784 (2002)
Jianzhi Zhang et al.
Nucleic acids research, 31(2), 602-607 (2003-01-16)
Here we report on the expression and function of RNase 7, one of the final RNase A superfamily ribonucleases identified in the human genome sequence. The human RNase 7 gene is expressed in various somatic tissues including the liver, kidney

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service