Skip to Content
Merck
All Photos(1)

Key Documents

AV36364

Sigma-Aldrich

Anti-CHD1L antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Chromodomain helicase DNA binding protein 1-like

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

45 kDa

species reactivity

mouse, rat, human, rabbit, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CHD1L(9557)

Immunogen

Synthetic peptide directed towards the middle region of human CHD1L

Biochem/physiol Actions

Chromodomain helicase DNA binding protein 1-like (CHD1L) is a DNA helicase and chromatin remodeling factor that is important in DNA repair. It converts ATP to poly (ADP-ribose) and regulates the chromatin relaxation during DNA repair. It has been identified as an oncogene that induces cell proliferation, apoptosis inhibition, G1/S phase transition and embryo development. CHD1L acts as a marker for prognosis of solid tumors such as hepatocellular carcinoma.

Sequence

Synthetic peptide located within the following region: DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jiyeon Hyeon et al.
Korean journal of pathology, 47(1), 9-15 (2013-03-14)
The gene for chromodomain helicase/ATPase DNA binding protein 1-like (CHD1L) was recently identified as a target oncogene within the 1q21 amplicon, which occurs in 46% to 86% of primary hepatocellular carcinoma (HCC) cases. However, the prognostic significance of CHD1L in
Wen Cheng et al.
Molecular cancer, 12(1), 170-170 (2013-12-24)
Comprehensive sequencing efforts have revealed the genomic landscapes of common forms of human cancer and  - 140 driver genes have been identified, but not all of them have been extensively investigated. CHD1L (chromodomain helicase/ATPase DNA binding protein 1-like gene) or
Alyssa C Snider et al.
Biology open, 2(2), 121-131 (2013-02-23)
During preimplantation development, the embryo must establish totipotency and enact the earliest differentiation choices, processes that involve extensive chromatin modification. To identify novel developmental regulators, we screened for genes that are preferentially transcribed in the pluripotent inner cell mass (ICM)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service