Skip to Content
Merck
All Photos(2)

Key Documents

AV100955

Sigma-Aldrich

Anti-MBP-1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CIRIP, Anti-HGNC:4920, Anti-MBP-1, Anti-PRDII-BF1, Anti-ZNF40

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

47 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... MBP-1(3096)

General description

Immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/Myc promoter-binding protein-1 (HIVEP1, CIRIP, MBP-1, ZNF40, PRDII-BF1) is a transcription factor involved in the activation of HIV-1 gene expression and the repression of c-myc gene expression.

Immunogen

Synthetic peptide directed towards the middle region of human ENO1

Application

Rabbit polyclonal anti-MBP-1 antibody is used to tag immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 in HIV-1 and c-myc gene expression. Anti-MBP-1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Rabbit polyclonal anti-MBP-1 antibody reacts with human immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 transcription factor.

Biochem/physiol Actions

MBP-1 binds to the GGGACTTTCC sequence motif found in enhancer elements of viral promoters. It regulates the transcription of both cellular and viral (HIV-1) genes.[1]

Sequence

Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

T Maekawa et al.
The Journal of biological chemistry, 264(25), 14591-14593 (1989-09-05)
The region containing two copies of the sequence GGGACTTTCC in the human immunodeficiency virus type 1 (HIV-1) long terminal repeat, that is an NF-kappa B binding site, functions as an enhancer element for HIV transcriptional regulation. By a Southwestern method

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service