Skip to Content
Merck
All Photos(12)

Key Documents

HPA011272

Sigma-Aldrich

Anti-ANXA1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Annexin A1, Anti-Annexin I, Anti-Annexin-1, Anti-Calpactin II, Anti-Chromobindin-9, Anti-Lipocortin I, Anti-Phospholipase A2 inhibitory protein, Anti-p35

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€483.00

€483.00


Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
€483.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

€483.00


Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, rat, mouse

enhanced validation

independent
RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ANXA1(301)

General description

Annexin A1 (ANXA1) belongs to the annexin gene family and is a part of the A subfamily. It is a glucocorticoid-regulated, calcium and phospholipid-binding protein. This protein has a molecular weight of 37kDa.

Immunogen

Annexin A1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Annexin A1 (ANXA1) is involved in multiple cellular functions such as, cell proliferation and differentiation and signal transduction. Its expression is deregulated in various cancers such as, glial tumors, nasopharyngeal carcinoma, head and neck, larynx, esophageal, breast, hepatocellular, gastric, prostate and pancreatic cancer. It is up-regulated in rectal cancer and predicts poor prognostic response to concurrent chemoradiotherapy. ANXA1 is involved in anti-inflammatory processes, and regulates apoptosis and phagocytosis of apoptotic bodies. Its expression levels are altered in cystic fibrosis, and might be involved in the pathogenesis of glomerular disorders. It has potential as a marker for the diagnosis and prognosis of glomerular disorders. ANXA1 has a high level of expression in normal gastrointestinal epithelium, and might be involved in the maintenance of cellular boundaries. It also regulates gastric cancer cell proliferation and viability through COX2 (cyclooxygenase 2) pathway.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71576

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Omar Elakad et al.
Disease markers, 2021, 5520832-5520832 (2021-05-08)
Lung cancer remains the primary cause of cancer-related death worldwide, and its molecular mechanisms of tumor progression need further characterization to improve the clinical management of affected patients. The role of Annexin A1 (ANXA1) in tumorigenesis and cancer progression in
Zhi-Qiang Zhang et al.
World journal of gastroenterology, 19(43), 7795-7803 (2013-11-28)
To study the differential expression of Annexin A1 (ANXA1) protein in human gastric adenocarcinoma. This study was also designed to analyze the relationship between ANXA1 expression and the clinicopathological parameters of gastric carcinoma. Purified gastric adenocarcinoma cells (GAC) and normal
Shuk-Man Ka et al.
Disease markers, 2014, 854163-854163 (2014-03-05)
We recently demonstrated high urine levels of annexin A1 (ANXA1) protein in a mouse Adriamycin-induced glomerulopathy (ADG) model. To establish ANXA1 as a potential biomarker for glomerular injury in patients. A time-course study in the mouse ADG model, followed by
Differential expression of ANXA1 in benign human gastrointestinal tissues and cancers.
Gao Y, Chen Y, Xu D, et al.
BMC Cancer, 14, 520-520 (2014)
Aifeng Liu et al.
Molecular medicine reports, 10(6), 3059-3067 (2014-10-18)
Nasopharyngeal carcinoma (NPC) has a highly increased incidence rate (20/100,000) in Southern regions of China, while being rare in the rest of the world. NPC is a malignant type of cancer due to its high occurrence rate of metastasis; however

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service