Skip to Content
Merck
All Photos(1)

Key Documents

AV51287

Sigma-Aldrich

Anti-TNNT3 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-AMCD2B, Anti-DA2B, Anti-DKFZp779M2348, Anti-FSSV, Anti-Troponin T type 3 (skeletal, fast)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€386.00

€386.00


Ships within 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
€386.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€386.00


Ships within 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

30 kDa

species reactivity

rabbit, bovine, horse, mouse, rat, dog, goat, human, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TNNT3(7140)

Immunogen

Synthetic peptide directed towards the N terminal region of human TNNT3

Application

Anti-TNNT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Biochem/physiol Actions

Troponin T type 3 (TNNT3) is a fast-twitch muscle protein belonging to the troponin T gene family. It forms a complex that regulates striated muscle contraction along with troponins C and I. Two isoforms of TNNT3 are present, the fetal/neonatal and the adult isoforms and a developmental switch of the isoforms occurs. Mutations in TNNT3 have been identified in distal arthrogryposis multiplex congenita type 2B and Sheldon-Hall syndrome.

Sequence

Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Tathagata Chaudhuri et al.
Journal of molecular biology, 352(1), 58-71 (2005-08-06)
In mammalian fast skeletal muscle, constitutive and alternative splicing from a single troponin T (TnT) gene produce multiple developmentally regulated and tissue specific TnT isoforms. Two exons, alpha (exon 16) and beta (exon 17), located near the 3' end of
Raymund Stefancsik et al.
Comparative and functional genomics, 4(6), 609-625 (2008-07-17)
We describe the cloning, sequencing and structure of the human fast skeletal troponin T (TNNT3) gene located on chromosome 11p15.5. The single-copy gene encodes 19 exons and 18 introns. Eleven of these exons, 1-3, 9-15 and 18, are constitutively spliced
Ning Zhao et al.
European journal of medical genetics, 54(3), 351-353 (2011-03-16)
Distal arthrogryposis (DA) is a group of rare, clinically and genetically heterogeneous disorders primarily characterized by congenital contractures of the limb joints. Recently, mutations in genes encoding the fast-twitch skeletal muscle contractile myofibers complex, including troponin I2 (TNNI2), troponin T3
P A Krakowiak et al.
American journal of medical genetics, 76(1), 93-98 (1998-03-21)
We describe the clinical characteristics of a provisionally unique form of distal arthrogryposis. The anomalies observed in affected individuals are more severe than those in distal arthrogryposis type 1 and are similar to but less dramatic than those described in

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service