Skip to Content
Merck
All Photos(3)

Key Documents

WH0055288M1

Sigma-Aldrich

Monoclonal Anti-RHOT1 antibody produced in mouse

clone 4H4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ARHT1, Anti-FLJ11040, Anti-FLJ12633, Anti-MIRO1, Anti-ras homolog gene family, member T1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4H4, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RHOT1(55288)

General description

Ras homolog family member T1 (RHOT1) is encoded by the gene mapped to human chromosome 17q11.2. RhoT1 is a member of mitochondrial Rho GTPase family.

Immunogen

RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP

Biochem/physiol Actions

Ras homolog family member T1 (RHOT1) plays an essential role in controlling mitochondrial homeostasis and apoptosis. RHOT1 serves as a tumor suppressor gene for pancreatic cancer (PC), and it can be considered as a potential prognostic biomarker for overall survival and as a promising therapeutic target for PC. Decreased expression of RHOT1 might result in lymph node metastasis (LNM) and shorter survival. RHOT1 has a crucial role to play in mitochondrial transport, lymphocyte migration, and polarity.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Pei-I Tsai et al.
Molecular biology of the cell, 28(24), 3471-3479 (2017-09-15)
MIC60/mitofilin constitutes a hetero-oligomeric complex on the inner mitochondrial membranes to maintain crista structure. However, little is known about its physiological functions. Here, by characterizing
Renu Bajaj et al.
Molecular cytogenetics, 4, 3-3 (2011-01-22)
To evaluate the clinical validity of genome-wide oligonucleotide array comparative genomic hybridization (aCGH) for detecting somatic abnormalities, we have applied this genomic analysis to 30 cases (13 MDS and 17 AML) with clonal chromosomal abnormalities detected in more than 50%
Hua Jiang et al.
PloS one, 7(7), e42234-e42234 (2012-08-04)
Cancer cell invasion and metastasis are the most important adverse prognostic factors for pancreatic cancer. Identification of biomarkers associated with outcome of pancreatic cancer may provide new approaches and targets for anticancer therapy. The aim of this study is to
Clara Berenguer-Escuder et al.
Journal of clinical medicine, 8(12) (2020-01-01)
Although most cases of Parkinson´s disease (PD) are idiopathic with unknown cause, an increasing number of genes and genetic risk factors have been discovered that play a role in PD pathogenesis. Many of the PD-associated proteins are involved in mitochondrial
Vinita Bharat et al.
Frontiers in cell and developmental biology, 9, 765408-765408 (2021-11-23)
Mutations in MAPT gene cause multiple neurological disorders, including frontal temporal lobar degeneration and parkinsonism. Increasing evidence indicates impaired mitochondrial homeostasis and mitophagy in patients and disease models of pathogenic MAPT. Here, using MAPT patients' fibroblasts as a model, we

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service