SAB2100330
Anti-CACNB2 (ab1) antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Calcium channel, voltage-dependent, β 2 subunit, Anti-FLJ23743, Anti-MYSB
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$541.00
$541.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
All Photos(1)
Select a Size
Change View
100 μL
$541.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$541.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
68 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
UniProt accession no.
shipped in
wet ice
Storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CACNB2(783)
General description
Calcium voltage-gated channel auxiliary subunit beta 2 (CACNB2) is a part of voltage-gated calcium channel gene superfamily and encodes Cavβ2 subunit. In human chromosome, the gene CACNB2 is localized on 10p12.33-p12.31.
Immunogen
Synthetic peptide directed towards the middle region of human CACNB2
Biochem/physiol Actions
CACNB2 contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. Defects in CACNB2 are the cause of Brugada syndrome type 4 (BRS4). CACNB2 is associated with systolic blood pressure and hypertension. Downregulation of CACNB2 expression leads to atrial fibrillation. Mutations in CACNB2 causes dysregulation of calcium levels in cells leading to autism spectrum disorder. Single nucleotide polymorphism in CACNB2 gene is associated with bipolar disorder and schizophrenia.
Sequence
Synthetic peptide located within the following region: HLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
The dark side of the QT interval. The Short QT Syndrome: pathophysiology, clinical presentation and management
Comelli I, et al.
Emergency Care Journal, 8(3), 41-47 (2012)
Regulation of cardiac CACNB2 by microRNA-499: Potential role in atrial fibrillation
Ling TY, et al.
BBA Clinical, 7(9875), 78-84 (2017)
Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis
Smoller JW
Lancet, 381(9875), 1371-1379 (2013)
Alexandra F S Breitenkamp et al.
PloS one, 9(4), e95579-e95579 (2014-04-23)
Autism Spectrum Disorders (ASD) are complex neurodevelopmental diseases clinically defined by dysfunction of social interaction. Dysregulation of cellular calcium homeostasis might be involved in ASD pathogenesis, and genes coding for the L-type calcium channel subunits CaV1.2 (CACNA1C) and CaVβ2 (CACNB2)
Yinghua Lin et al.
Atherosclerosis, 219(2), 709-714 (2011-10-04)
Two large-scale genome-wide association studies (GWAs) have identified multiple variants associated with blood pressure (BP) or hypertension. The present study was to investigate whether some variations were associated with BP traits and hypertension or even prehypertension in adult She ethnic
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
