WH0004609M2
Monoclonal Anti-MYC antibody produced in mouse
clone 1G7, purified immunoglobulin, buffered aqueous solution
Synonim(y):
Anti-cMyc, Anti-v-Myc myelocytomatosis viral oncogene homolog (avian)
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
Polecane produkty
pochodzenie biologiczne
mouse
białko sprzężone
unconjugated
forma przeciwciała
purified immunoglobulin
rodzaj przeciwciała
primary antibodies
klon
1G7, monoclonal
Postać
buffered aqueous solution
reaktywność gatunkowa
human
metody
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
izotyp
IgG3κ
numer dostępu GenBank
numer dostępu UniProt
Warunki transportu
dry ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... MYC(4609)
Opis ogólny
MYC (MYC proto-oncogene) is a transcriptional factor and oncoprotein. c-myc is a member of MYC gene family. It is located on human chromosome 8q24. c-Myc gene codes for basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor.
The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-terminal. The synthesis of non-AUG initiated protein is suppressed in Burkitt′s lymphomas, suggesting its importance in the normal function of this gene. (provided by RefSeq)
Immunogen
MYC (NP_002458, 330 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Sequence
VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Działania biochem./fizjol.
The cellular myelocytomatosis (c-myc) oncogene plays a major role in cellular proliferation, differentiation and apoptosis. It acts as transcriptional regulator of gene expression. MYC (MYC proto-oncogene) may be essential for cancer initiation, promotion and therapy resistance. Overexpression of MYC in DLBCL (diffuse large B-cell lymphoma) results in poor outcome and invasive treatment when medicated with rituximab plus cyclophosphamide, doxorubicin, vincristine and prednisone (R-CHOP).
Postać fizyczna
Solution in phosphate buffered saline, pH 7.4
Informacje prawne
GenBank is a registered trademark of United States Department of Health and Human Services
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Narzędzie selektora produktów.
polecane
Kod klasy składowania
10 - Combustible liquids
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Klienci oglądali również te produkty
Clinicopathological significance of c-MYC in esophageal squamous cell carcinoma
Lian Y, et al.
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine (2017)
Fei Wang et al.
Science signaling, 15(719), eabd0033-eabd0033 (2022-02-02)
Social memory enables one to recognize and distinguish specific individuals. It is fundamental to social behaviors that can be mediated by the oxytocin receptor (OXTR), such as forming relationships. We investigated the molecular regulation and function of OXTR in animal
Yimeng Yin et al.
The Biochemical journal, 452(1), 67-78 (2013-02-27)
The NXF (nuclear export factor) family members are implicated in the transport of mRNA from the nucleus to the cytoplasm. Recently, some members of the NXF family have been reported to play divergent functional roles, such as post-transcriptional regulation, translational
Wenjing Yan et al.
Nature communications, 14(1), 4798-4798 (2023-08-10)
UBA1 is the primary E1 ubiquitin-activating enzyme responsible for generation of activated ubiquitin required for ubiquitination, a process that regulates stability and function of numerous proteins. Decreased or insufficient ubiquitination can cause or drive aging and many diseases. Therefore, a
Apoptotic signaling by c-MYC.
Hoffman B, et al.
Oncogene, 27(50), 6462-6472 (2008)
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej