The sequence for Product SRP0164, Histone H4 (2-58) human is as follows:SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV
Przejdź do
SRP0164
Histone H4 (2-58) human
recombinant, expressed in E. coli, ≥70% (SDS-PAGE)
Synonim(y):
HIST2H4A
Zaloguj się, aby wyświetlić ceny organizacyjne i kontraktowe.
Wybierz wielkość
Zmień widok
| Rozmiar/SKU | Dostępność | Cena netto |
|---|---|---|
500 μg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 1780,00 zł |
Informacje o tej pozycji
NACRES:
NA.77
UNSPSC Code:
12352200
Form:
aqueous solution
Assay:
≥70% (SDS-PAGE)
Biological source:
human
Recombinant:
expressed in E. coli
Mol wt:
32 kDa
1780,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Pomoc techniczna
Potrzebujesz pomocy? Nasz zespół doświadczonych naukowców chętnie Ci pomoże.
Pozwól nam pomócbiological source
human
recombinant
expressed in E. coli
assay
≥70% (SDS-PAGE)
form
aqueous solution
mol wt
32 kDa
packaging
pkg of 500 μg
storage condition
avoid repeated freeze/thaw cycles
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−70°C
Gene Information
human ... HIST2H4A(8370)
General description
Human Histone 4 (GenBank Accession No. NM_003548), (2-58) with N-terminal GST-tag, MW = 32 kDa, expressed in an E. coli expression system.
Physical form
Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.
Preparation Note
Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.
Ta strona może zawierać tekst przetłumaczony maszynowo.
1 of 1
Ta pozycja | |||
|---|---|---|---|
| description recombinant, expressed in E. coli, ≥70% (SDS-PAGE) | description recombinant, expressed in E. coli, ≥80% (SDS-PAGE) | description ≥90% (HPLC) | description recombinant, expressed in E. coli, ≥70% (SDS-PAGE) |
| recombinant expressed in E. coli | recombinant expressed in E. coli | recombinant - | recombinant expressed in E. coli |
| biological source human | biological source human | biological source human | biological source human |
| assay ≥70% (SDS-PAGE) | assay ≥80% (SDS-PAGE) | assay ≥90% (HPLC) | assay ≥70% (SDS-PAGE) |
| mol wt 32 kDa | mol wt 12.1 kDa | mol wt ~2 kDa | mol wt 32 kDa |
| form aqueous solution | form aqueous solution | form aqueous solution | form aqueous solution |
| storage condition avoid repeated freeze/thaw cycles | storage condition avoid repeated freeze/thaw cycles | storage condition avoid repeated freeze/thaw cycles | storage condition avoid repeated freeze/thaw cycles |
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
-
What is the amino acid sequence of Histone H4 (2-58) human, Product SRP0164?
1 answer-
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-