The sequence for product SRP0158, Histone H3 (2-58) human, is as follows:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS
Przejdź do
SRP0158
Histone H3 (2-58) human
recombinant, expressed in E. coli, ≥70% (SDS-PAGE)
Synonim(y):
HIST1H3E, Histone H3.1
Zaloguj się, aby wyświetlić ceny organizacyjne i kontraktowe.
Wybierz wielkość
Zmień widok
| Do Państwa/SKU | Dostępność | Cena netto |
|---|---|---|
500 μg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 2350,00 zł |
Informacje o tej pozycji
NACRES:
NA.32
UNSPSC Code:
12352200
Form:
aqueous solution
Assay:
≥70% (SDS-PAGE)
Biological source:
human
Recombinant:
expressed in E. coli
Mol wt:
32 kDa
2350,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Pomoc techniczna
Potrzebujesz pomocy? Nasz zespół doświadczonych naukowców chętnie Ci pomoże.
Pozwól nam pomócbiological source
human
recombinant
expressed in E. coli
assay
≥70% (SDS-PAGE)
form
aqueous solution
mol wt
32 kDa
packaging
pkg of 500 μg
storage condition
avoid repeated freeze/thaw cycles
concentration
>0.02 mg/mL
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−70°C
Gene Information
human ... HIST1H3E(8353)
General description
The mammalian chromatin is present in nucleosomes, made of histone octamers (H2A,H2B,H3,H4)2. Mammals contain three main classes of histone H3 variants: the replicative histones (H3.1 and H3.2), the replacement histone (H3.3) and the centromeric histone (Cenp-A).
Human Histone 3 (GenBank Accession No. NM_003532), (amino acid 2-58) with N-terminal GST tag, MW = 32kDa, expressed in an Escherichia coli expression system.
Human Histone 3 (GenBank Accession No. NM_003532), (amino acid 2-58) with N-terminal GST tag, MW = 32kDa, expressed in an Escherichia coli expression system.
Application
Suitable substrate for histone methyltransferases
Biochem/physiol Actions
Physical form
Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.
Preparation Note
Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.
Ta strona może zawierać tekst przetłumaczony maszynowo.
1 of 1
Ta pozycja | |||
|---|---|---|---|
| description recombinant, expressed in E. coli, ≥70% (SDS-PAGE) | description recombinant, expressed in E. coli, ≥80% (SDS-PAGE) | description ≥90% (HPLC) | description ≥90% (HPLC) |
| biological source human | biological source human | biological source human | biological source human |
| assay ≥70% (SDS-PAGE) | assay ≥80% (SDS-PAGE) | assay ≥90% (HPLC) | assay ≥90% (HPLC) |
| recombinant expressed in E. coli | recombinant expressed in E. coli | recombinant - | recombinant - |
| concentration >0.02 mg/mL | concentration >0.02 mg/mL | concentration >0.02 mg/mL | concentration 0.55 mg/mL |
| form aqueous solution | form aqueous solution | form aqueous solution | form aqueous solution |
| mol wt 32 kDa | mol wt 15.4 kDa | mol wt ~2 kDa | mol wt 2283 Da |
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
-
What is the amino acid sequence of Histone H3 (2-58) human, product SRP0158?
1 answer-
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-