SAB1408098

Anti-FBXW9 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonim(y): Fbw9, MGC10870
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~14.3 kDa
• reaktywność gatunkowa: human
• metody: western blot: 1 μg/mL
• numer dostępu NCBI: NM_032301.1
• numer dostępu UniProt: Q5XUX1
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... FBXW9(84261)

Opis

Opis ogólny

Members of the F-box protein family, such as FBXW9, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM

Immunogen

FBXW9 (ENSP00000254324, 1 a.a. ~ 135 a.a) full-length human protein.

Sequence
MTGTSSQAARTTPWWWWTAEPTASCSVCSWTPTCSACPTRNPSSGLVTTRACCTSSPTATAASSLSGPLMWATAFPSLGSSTPWEPCTPHPLTRPSGCTCPQTHQGPFAPEGMTMGSIGSVLRATWWWPALETCR

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable