Uniprot P02754 describes beta Lactoglobulin.The first 16 amino acids of that sequence are the signal peptide, so the sequence of beta-Lactoglobulin B corresponds to amino acids 17-178.But Product L7880 is beta-Lactoglobulin A. As shown in the details under the first link, this form of the protein varies by two amino acids from beta-Lactoglobulin B:1. Instead of the glycine (G) at position 80 of the B form, the A form has an aspartic acid (D).2. Instead of the alaline (A) at position 134 of the B form, the A form has a valine (V).So to answer your question, the sequence of Product L7880 is:LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Przejdź do
Wybierz wielkość
| Do Państwa/SKU | Dostępność | Cena netto |
|---|---|---|
10 mg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 474,00 zł |
25 mg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 780,00 zł |
100 mg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 2300,00 zł |
250 mg | Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności | 4980,00 zł |
Informacje o tej pozycji
474,00 zł
biological source
bovine milk
Quality Segment
assay
≥90% (PAGE)
form
powder
mol wt
18,363 Da by calculation
technique(s)
HPLC: suitable
UniProt accession no.
storage temp.
2-8°C
Gene Information
bovine ... LGB(280838)
General description
Application
- as a calibrant for the calibration of the TriWave device
- as a standard in the detection and quantification of β-lactoglobulin in bovine milk by reverse-phase high performance liquid chromatography (HPLC)
- in the purification and molecular weight measurement of protease samples
Biochem/physiol Actions
1 of 1
Ta pozycja | |||
|---|---|---|---|
| description ≥90% (PAGE) | description Isoelectric focusing marker, pI 5.1 | description ≥90% (PAGE) | description ≥90% (PAGE), lyophilized powder |
| assay ≥90% (PAGE) | assay - | assay ≥90% (PAGE) | assay ≥90% (PAGE) |
| technique(s) HPLC: suitable | technique(s) isoelectric focusing (IEF): suitable | technique(s) HPLC: suitable, electrophoresis: suitable | technique(s) - |
| biological source bovine milk | biological source bovine milk | biological source bovine milk | biological source bovine milk |
| mol wt 18,363 Da by calculation | mol wt - | mol wt 18,276 Da by calculation | mol wt - |
| form powder | form powder | form powder | form lyophilized powder |
| UniProt accession no. | UniProt accession no. | UniProt accession no. | UniProt accession no. |
Still not finding the right product?
Explore all of our products under β-Lactoglobulin A from bovine milk
Klasa składowania
11 - Combustible Solids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, type N95 (US)
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
-
Do you have the amino acid sequence of Product L7880, β-Lactoglobulin A from bovine milk?
1 answer-
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-



