AV44276

Anti-CYBB antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-CGD, Anti-Cytochrome b-245, β polypeptide (chronic granulomatous disease), Anti-GP91-1, Anti-GP91-PHOX, Anti-NOX2
• Numer MDL: MFCD02686174
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• białko sprzężone: unconjugated
• Poziom jakości: 100
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 63 kDa
• reaktywność gatunkowa: rabbit, mouse, human, rat
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_000388
• numer dostępu UniProt: P04839
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CYBB(1536)

Opis

Opis ogólny

Cytochrome b-245 is a major component of the microbicidal oxidase system of human leucocytes including eosinophils, monocytes, macrophages and neutrophils. Cytochrome b-245 is thought to be the terminal component of the microbicidal oxidase electron transport chain leading to the respiratory burst of phagocytic neutrophil cells which generates superoxide-free radials. Defects in cytochrome b-245 have been linked to chronic granulomatous disease.

Specyficzność

Anti-CγBB polyclonal antibody reacts with human, mouse, rat, bovine, chicken, rabbit, and canine cytochrome b-245 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human CY24B

Zastosowanie

Anti-CγBB polyclonal antibody is used to tag cytochrome b-245 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cytochrome b-245 in microbicidal oxidase respiratory burst of phagocytic cells.

Działania biochem./fizjol.

Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.

Sekwencja

Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable