AV03005

Anti-CDK6 antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Cyclin-dependent kinase 6, Anti-MGC59692, Anti-PLSTIRE
• NACRES: NA.43
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 3

Właściwości

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 37 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001250
• UniProt accession no.: Q00534
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CDK6(1021)

Opis

General description

CDK6 is a cyclin-dependent kinase important in regulating cell cycle progression specifically transitioning from G1 to G1/S phase.

Immunogen

Synthetic peptide directed towards the C terminal region of human CDK6

Application

Anti-CDK6 antibody produced in rabbit is suitable for western blotting at a concentration of 0.625 μg/ml.

Biochem/physiol Actions

CDK6 is a D-type cyclin dependent kinase that initiates the phosphorylation of Rb tumor suppressor protein. In selected cell types the cyclin D/CDK6 activity is essential for cell proliferation. In collaboration with pRb, CDK6 has been discovered to play an important role in cell differentiation and in maintaining the cell cycle exit during differentiation.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable